Lineage for d1pumb1 (1pum B:1-137)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464433Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 464434Family b.42.2.1: Ricin B-like [50371] (6 proteins)
  6. 464453Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 464460Species European mistletoe (Viscum album) [TaxId:3972] [50375] (9 PDB entries)
    different sequence variants
  8. 464467Domain d1pumb1: 1pum B:1-137 [104315]
    Other proteins in same PDB: d1puma_

Details for d1pumb1

PDB Entry: 1pum (more details), 2.3 Å

PDB Description: mistletoe lectin i in complex with galactose

SCOP Domain Sequences for d1pumb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pumb1 b.42.2.1 (B:1-137) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)}
ddvtcsasepivrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs
ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt
vqtldytlgqgwlagnd

SCOP Domain Coordinates for d1pumb1:

Click to download the PDB-style file with coordinates for d1pumb1.
(The format of our PDB-style files is described here.)

Timeline for d1pumb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pumb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1puma_