![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (15 proteins) |
![]() | Protein Mistletoe lectin I A-chain [56381] (1 species) |
![]() | Species European mistletoe (Viscum album) [TaxId:3972] [56382] (11 PDB entries) different sequence variants |
![]() | Domain d1puma_: 1pum A: [104314] Other proteins in same PDB: d1pumb1, d1pumb2 complexed with cl, fuc, glb, gol, nag, so4 |
PDB Entry: 1pum (more details), 2.3 Å
SCOP Domain Sequences for d1puma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1puma_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]} yerlslrtvqqttgaeyfsfitllrdfvssgsfsnqipllrqstipvsegqrfvlveltn aggdsitaaidvtnlyvvayragdqsyflkdapagaetqdfagttrsslpfngsypdler yaghrdqiplgidqliasvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi nsgasflpdvymleletswgqqstqvqhstdgvfnnpialalspgsvvtltnvrdviasl aimlfvcge
Timeline for d1puma_: