SCOPe 2.07: Domain d1pu2a2: 1pu2 A:134-357

Lineage for d1pu2a2 (1pu2 A:134-357)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)

7. Species Haemophilus influenzae [TaxId:727] [103103] (12 PDB entries)
   Uniprot P44801

8. Domain d1pu2a2: 1pu2 A:134-357 [104309]
   Other proteins in same PDB: d1pu2a1
   mutant

Details for d1pu2a2

PDB Entry: 1pu2, 2.06 Å

PDB Description: crystal structure of the k246r mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae

PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1pu2a2:

Sequence; same for both SEQRES and ATOM records:

>d1pu2a2 d.81.1.1 (A:134-357) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
gnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkd
passildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewrgyaetnk
ilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndke
itlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwg

Timeline for d1pu2a2:

• d1pu2a2 first appeared in SCOP 1.69
  
• d1pu2a2 appears in SCOPe 2.06
  
• d1pu2a2 appears in the current release, SCOPe 2.08