SCOPe 2.07: Domain d1pu1a_: 1pu1 A:

Lineage for d1pu1a_ (1pu1 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.266: Hypothetical protein MTH677 [110782] (1 superfamily)
   alpha-beta(2)-alpha; 2 layers a/b; antiparallel beta-hairpin

4. Superfamily d.266.1: Hypothetical protein MTH677 [110783] (1 family)
   automatically mapped to Pfam PF11419

5. Family d.266.1.1: Hypothetical protein MTH677 [110784] (1 protein)

6. Protein Hypothetical protein MTH677 [110785] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [110786] (1 PDB entry)
   Uniprot O26773

8. Domain d1pu1a_: 1pu1 A: [104307]
   Structural genomics target

Details for d1pu1a_

PDB Entry: 1pu1

PDB Description: solution structure of the hypothetical protein mth677 from methanothermobacter thermautotrophicus

PDB Compounds: (A:) Hypothetical protein MTH677

SCOPe Domain Sequences for d1pu1a_:

Sequence; same for both SEQRES and ATOM records:

>d1pu1a_ d.266.1.1 (A:) Hypothetical protein MTH677 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mslrkltegdldeissflhntisdfilkrvsakeivdiditvlveytdelkvdisaelyl
delsdadpgivdeavdaayrslesfldgfre

Timeline for d1pu1a_:

• d1pu1a_ first appeared in SCOP 1.69
  
• d1pu1a_ appears in SCOPe 2.06
  
• d1pu1a_ appears in the current release, SCOPe 2.08