Lineage for d1pu1a_ (1pu1 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516910Fold d.266: Hypothetical protein MTH677 [110782] (1 superfamily)
    alpha-beta(2)-alpha; 2 layers a/b; antiparallel beta-hairpin
  4. 516911Superfamily d.266.1: Hypothetical protein MTH677 [110783] (1 family) (S)
  5. 516912Family d.266.1.1: Hypothetical protein MTH677 [110784] (1 protein)
  6. 516913Protein Hypothetical protein MTH677 [110785] (1 species)
  7. 516914Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [110786] (1 PDB entry)
  8. 516915Domain d1pu1a_: 1pu1 A: [104307]
    Structural genomics target

Details for d1pu1a_

PDB Entry: 1pu1 (more details)

PDB Description: solution structure of the hypothetical protein mth677 from methanothermobacter thermautotrophicus

SCOP Domain Sequences for d1pu1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pu1a_ d.266.1.1 (A:) Hypothetical protein MTH677 {Archaeon Methanobacterium thermoautotrophicum}
mslrkltegdldeissflhntisdfilkrvsakeivdiditvlveytdelkvdisaelyl
delsdadpgivdeavdaayrslesfldgfre

SCOP Domain Coordinates for d1pu1a_:

Click to download the PDB-style file with coordinates for d1pu1a_.
(The format of our PDB-style files is described here.)

Timeline for d1pu1a_: