Lineage for d1pu1a_ (1pu1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009251Fold d.266: Hypothetical protein MTH677 [110782] (1 superfamily)
    alpha-beta(2)-alpha; 2 layers a/b; antiparallel beta-hairpin
  4. 3009252Superfamily d.266.1: Hypothetical protein MTH677 [110783] (1 family) (S)
    automatically mapped to Pfam PF11419
  5. 3009253Family d.266.1.1: Hypothetical protein MTH677 [110784] (1 protein)
  6. 3009254Protein Hypothetical protein MTH677 [110785] (1 species)
  7. 3009255Species Methanobacterium thermoautotrophicum [TaxId:145262] [110786] (1 PDB entry)
    Uniprot O26773
  8. 3009256Domain d1pu1a_: 1pu1 A: [104307]
    Structural genomics target

Details for d1pu1a_

PDB Entry: 1pu1 (more details)

PDB Description: solution structure of the hypothetical protein mth677 from methanothermobacter thermautotrophicus
PDB Compounds: (A:) Hypothetical protein MTH677

SCOPe Domain Sequences for d1pu1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pu1a_ d.266.1.1 (A:) Hypothetical protein MTH677 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mslrkltegdldeissflhntisdfilkrvsakeivdiditvlveytdelkvdisaelyl
delsdadpgivdeavdaayrslesfldgfre

SCOPe Domain Coordinates for d1pu1a_:

Click to download the PDB-style file with coordinates for d1pu1a_.
(The format of our PDB-style files is described here.)

Timeline for d1pu1a_: