Lineage for d1ps0a1 (1ps0 A:1-152,A:321-360)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2394951Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2394952Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2395084Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2395360Protein Cinnamyl alcohol dehydrogenase, ADH6 [110173] (1 species)
  7. 2395361Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110174] (3 PDB entries)
    Uniprot Q04894
  8. 2395365Domain d1ps0a1: 1ps0 A:1-152,A:321-360 [104302]
    Other proteins in same PDB: d1ps0a2
    complexed with nap, zn

Details for d1ps0a1

PDB Entry: 1ps0 (more details), 3.01 Å

PDB Description: Crystal Structure of the NADP(H)-Dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
PDB Compounds: (A:) Hypothetical zinc-type alcohol dehydrogenase-like protein in PRE5-FET4 intergenic region

SCOPe Domain Sequences for d1ps0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ps0a1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm
kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt
ysqpyedgyvsqggyanyvrvhehfvvpipenXiwvetlpvgeagvheafermekgdvry
rftlvgydkefsd

SCOPe Domain Coordinates for d1ps0a1:

Click to download the PDB-style file with coordinates for d1ps0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ps0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ps0a2