Lineage for d1pr3a2 (1pr3 A:134-357)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506899Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 506900Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 506901Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 506908Protein Aspartate beta-semialdehyde dehydrogenase [55361] (3 species)
  7. 506920Species Haemophilus influenzae [TaxId:727] [103103] (10 PDB entries)
  8. 506927Domain d1pr3a2: 1pr3 A:134-357 [104301]
    Other proteins in same PDB: d1pr3a1

Details for d1pr3a2

PDB Entry: 1pr3 (more details), 2.15 Å

PDB Description: crystal structure of the r103k mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae

SCOP Domain Sequences for d1pr3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pr3a2 d.81.1.1 (A:134-357) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae}
gnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkd
passildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnk
ilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndke
itlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwg

SCOP Domain Coordinates for d1pr3a2:

Click to download the PDB-style file with coordinates for d1pr3a2.
(The format of our PDB-style files is described here.)

Timeline for d1pr3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pr3a1