Lineage for d1pqza2 (1pqz A:5-143)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719981Protein Immunomodulatory protein m144, alpha-1 and alpha-2 domains [110841] (1 species)
  7. 719982Species Murine cytomegalovirus [TaxId:10366] [110842] (1 PDB entry)
  8. 719983Domain d1pqza2: 1pqz A:5-143 [104298]
    Other proteins in same PDB: d1pqza1, d1pqzb_

Details for d1pqza2

PDB Entry: 1pqz (more details), 2.1 Å

PDB Description: murine cytomegalovirus immunomodulatory protein m144
PDB Compounds: (A:) mcmv m144

SCOP Domain Sequences for d1pqza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqza2 d.19.1.1 (A:5-143) Immunomodulatory protein m144, alpha-1 and alpha-2 domains {Murine cytomegalovirus [TaxId: 10366]}
gsesglryaytlvvdgtantarcfgtghvdgeafvgysnnkthgigrwvnashveeenke
fvrqckelqaeldkmqnnsavigvktvqldvgctskiekhyaydgneteddtatsasera
rdcqkklteyrklvlasav

SCOP Domain Coordinates for d1pqza2:

Click to download the PDB-style file with coordinates for d1pqza2.
(The format of our PDB-style files is described here.)

Timeline for d1pqza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pqza1
View in 3D
Domains from other chains:
(mouse over for more information)
d1pqzb_