Lineage for d1pqza1 (1pqz A:144-242)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 550338Protein Immunomodulatory protein m144, alpha-3 domain [110048] (1 species)
  7. 550339Species Murine cytomegalovirus [TaxId:10366] [110049] (1 PDB entry)
  8. 550340Domain d1pqza1: 1pqz A:144-242 [104297]
    Other proteins in same PDB: d1pqza2, d1pqzb_

Details for d1pqza1

PDB Entry: 1pqz (more details), 2.1 Å

PDB Description: murine cytomegalovirus immunomodulatory protein m144

SCOP Domain Sequences for d1pqza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqza1 b.1.1.2 (A:144-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus}
spqleverrssgreggmrlrcfardyypadleirwwkddggggalpqtskqhhdplpsgq
glyqkhidvyvdgglehvyscrvkgiatglelqivrwkg

SCOP Domain Coordinates for d1pqza1:

Click to download the PDB-style file with coordinates for d1pqza1.
(The format of our PDB-style files is described here.)

Timeline for d1pqza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pqza2
View in 3D
Domains from other chains:
(mouse over for more information)
d1pqzb_