Lineage for d1pqza1 (1pqz A:144-242)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749664Protein Immunomodulatory protein m144, alpha-3 domain [110048] (1 species)
  7. 2749665Species Murine cytomegalovirus [TaxId:10366] [110049] (2 PDB entries)
    Uniprot Q69G19 27-263 # 95% sequence identity
  8. 2749667Domain d1pqza1: 1pqz A:144-242 [104297]
    Other proteins in same PDB: d1pqza2, d1pqzb_

Details for d1pqza1

PDB Entry: 1pqz (more details), 2.1 Å

PDB Description: murine cytomegalovirus immunomodulatory protein m144
PDB Compounds: (A:) mcmv m144

SCOPe Domain Sequences for d1pqza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqza1 b.1.1.2 (A:144-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]}
spqleverrssgreggmrlrcfardyypadleirwwkddggggalpqtskqhhdplpsgq
glyqkhidvyvdgglehvyscrvkgiatglelqivrwkg

SCOPe Domain Coordinates for d1pqza1:

Click to download the PDB-style file with coordinates for d1pqza1.
(The format of our PDB-style files is described here.)

Timeline for d1pqza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pqza2
View in 3D
Domains from other chains:
(mouse over for more information)
d1pqzb_