SCOPe 2.07: Domain d1pqxa1: 1pqx A:1-83

Lineage for d1pqxa1 (1pqx A:1-83)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.267: Hypothetical protein SAV1430 [110835] (1 superfamily)
   beta(3)-alpha-beta(2)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet, order: 12543

4. Superfamily d.267.1: Hypothetical protein SAV1430 [110836] (2 families)
   automatically mapped to Pfam PF08712

5. Family d.267.1.1: Hypothetical protein SAV1430 [110837] (2 proteins)

6. Protein Hypothetical protein SAV1430 [110838] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110839] (3 PDB entries)
   Uniprot Q99U58

8. Domain d1pqxa1: 1pqx A:1-83 [104296]
   Other proteins in same PDB: d1pqxa2

Details for d1pqxa1

PDB Entry: 1pqx

PDB Description: solution nmr structure of staphylococcus aureus protein sav1430. northeast structural genomics consortium target zr18.

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1pqxa1:

Sequence; same for both SEQRES and ATOM records:

>d1pqxa1 d.267.1.1 (A:1-83) Hypothetical protein SAV1430 {Staphylococcus aureus [TaxId: 1280]}
mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdf
isvdkendanwetvlpkveavfe

Timeline for d1pqxa1:

• d1pqxa1 first appeared in SCOP 1.69, called d1pqxa_
  
• d1pqxa1 appears in SCOPe 2.06
  
• d1pqxa1 appears in the current release, SCOPe 2.08