SCOP 1.71: Domain d1pqxa_: 1pqx A:

Lineage for d1pqxa_ (1pqx A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.267: Hypothetical protein SAV1430 [110835] (1 superfamily)
   beta(3)-alpha-beta(2)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet, order: 12543

4. Superfamily d.267.1: Hypothetical protein SAV1430 [110836] (1 family)

5. Family d.267.1.1: Hypothetical protein SAV1430 [110837] (1 protein)

6. Protein Hypothetical protein SAV1430 [110838] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110839] (1 PDB entry)

8. Domain d1pqxa_: 1pqx A: [104296]

Details for d1pqxa_

PDB Entry: 1pqx

PDB Description: solution nmr structure of staphylococcus aureus protein sav1430. northeast structural genomics consortium target zr18.

SCOP Domain Sequences for d1pqxa_:

Sequence; same for both SEQRES and ATOM records:

>d1pqxa_ d.267.1.1 (A:) Hypothetical protein SAV1430 {Staphylococcus aureus}
mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdf
isvdkendanwetvlpkveavfelehhhhhh

Timeline for d1pqxa_:

• d1pqxa_ first appeared in SCOP 1.69
  
• d1pqxa_ appears in SCOP 1.73
  
• d1pqxa_ appears in the current release, SCOPe 2.08, called d1pqxa1