Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.267: Hypothetical protein SAV1430 [110835] (1 superfamily) beta(3)-alpha-beta(2)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet, order: 12543 |
Superfamily d.267.1: Hypothetical protein SAV1430 [110836] (1 family) |
Family d.267.1.1: Hypothetical protein SAV1430 [110837] (1 protein) |
Protein Hypothetical protein SAV1430 [110838] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [110839] (1 PDB entry) |
Domain d1pqxa_: 1pqx A: [104296] |
PDB Entry: 1pqx (more details)
SCOP Domain Sequences for d1pqxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pqxa_ d.267.1.1 (A:) Hypothetical protein SAV1430 {Staphylococcus aureus} mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdf isvdkendanwetvlpkveavfelehhhhhh
Timeline for d1pqxa_: