Lineage for d1pqxa_ (1pqx A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516916Fold d.267: Hypothetical protein SAV1430 [110835] (1 superfamily)
    beta(3)-alpha-beta(2)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet, order: 12543
  4. 516917Superfamily d.267.1: Hypothetical protein SAV1430 [110836] (1 family) (S)
  5. 516918Family d.267.1.1: Hypothetical protein SAV1430 [110837] (1 protein)
  6. 516919Protein Hypothetical protein SAV1430 [110838] (1 species)
  7. 516920Species Staphylococcus aureus [TaxId:1280] [110839] (1 PDB entry)
  8. 516921Domain d1pqxa_: 1pqx A: [104296]

Details for d1pqxa_

PDB Entry: 1pqx (more details)

PDB Description: solution nmr structure of staphylococcus aureus protein sav1430. northeast structural genomics consortium target zr18.

SCOP Domain Sequences for d1pqxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqxa_ d.267.1.1 (A:) Hypothetical protein SAV1430 {Staphylococcus aureus}
mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdf
isvdkendanwetvlpkveavfelehhhhhh

SCOP Domain Coordinates for d1pqxa_:

Click to download the PDB-style file with coordinates for d1pqxa_.
(The format of our PDB-style files is described here.)

Timeline for d1pqxa_: