Lineage for d1pqxa1 (1pqx A:1-83)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565699Fold d.267: Hypothetical protein SAV1430 [110835] (1 superfamily)
    beta(3)-alpha-beta(2)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet, order: 12543
  4. 2565700Superfamily d.267.1: Hypothetical protein SAV1430 [110836] (2 families) (S)
    automatically mapped to Pfam PF08712
  5. 2565701Family d.267.1.1: Hypothetical protein SAV1430 [110837] (2 proteins)
  6. 2565702Protein Hypothetical protein SAV1430 [110838] (1 species)
  7. 2565703Species Staphylococcus aureus [TaxId:1280] [110839] (3 PDB entries)
    Uniprot Q99U58
  8. 2565706Domain d1pqxa1: 1pqx A:1-83 [104296]
    Other proteins in same PDB: d1pqxa2

Details for d1pqxa1

PDB Entry: 1pqx (more details)

PDB Description: solution nmr structure of staphylococcus aureus protein sav1430. northeast strucutral genomics consortium target zr18.
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1pqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqxa1 d.267.1.1 (A:1-83) Hypothetical protein SAV1430 {Staphylococcus aureus [TaxId: 1280]}
mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdf
isvdkendanwetvlpkveavfe

SCOPe Domain Coordinates for d1pqxa1:

Click to download the PDB-style file with coordinates for d1pqxa1.
(The format of our PDB-style files is described here.)

Timeline for d1pqxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pqxa2