Lineage for d1pqud1 (1pqu D:1-133,D:358-371)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828665Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 1828677Species Haemophilus influenzae [TaxId:727] [102159] (12 PDB entries)
    Uniprot P44801
  8. 1828681Domain d1pqud1: 1pqu D:1-133,D:358-371 [104294]
    Other proteins in same PDB: d1pqua2, d1pqub2, d1pquc2, d1pqud2
    complexed with cac, cys, nap; mutant

Details for d1pqud1

PDB Entry: 1pqu (more details), 1.92 Å

PDB Description: crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with nadp, s-methyl cysteine sulfoxide and cacodylate
PDB Compounds: (D:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1pqud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqud1 c.2.1.3 (D:1-133,D:358-371) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
seglkkgiktfvgXaaepvrrilkqlva

SCOPe Domain Coordinates for d1pqud1:

Click to download the PDB-style file with coordinates for d1pqud1.
(The format of our PDB-style files is described here.)

Timeline for d1pqud1: