![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
![]() | Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [103103] (12 PDB entries) Uniprot P44801 |
![]() | Domain d1pqub2: 1pqu B:134-357 [104291] Other proteins in same PDB: d1pqua1, d1pqub1, d1pquc1, d1pqud1 complexed with cac, cys, nap; mutant |
PDB Entry: 1pqu (more details), 1.92 Å
SCOPe Domain Sequences for d1pqub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pqub2 d.81.1.1 (B:134-357) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]} gnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkd passildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnk ilglsdnpipvdglcvrigalrcnsqaftiklkkdlpleeieqiiashnewvkvipndke itlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwg
Timeline for d1pqub2: