Lineage for d1pqub2 (1pqu B:134-357)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506899Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 506900Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 506901Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 506908Protein Aspartate beta-semialdehyde dehydrogenase [55361] (3 species)
  7. 506920Species Haemophilus influenzae [TaxId:727] [103103] (10 PDB entries)
  8. 506933Domain d1pqub2: 1pqu B:134-357 [104291]
    Other proteins in same PDB: d1pqua1, d1pqub1, d1pquc1, d1pqud1

Details for d1pqub2

PDB Entry: 1pqu (more details), 1.92 Å

PDB Description: crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with nadp, s-methyl cysteine sulfoxide and cacodylate

SCOP Domain Sequences for d1pqub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqub2 d.81.1.1 (B:134-357) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae}
gnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkd
passildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnk
ilglsdnpipvdglcvrigalrcnsqaftiklkkdlpleeieqiiashnewvkvipndke
itlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwg

SCOP Domain Coordinates for d1pqub2:

Click to download the PDB-style file with coordinates for d1pqub2.
(The format of our PDB-style files is described here.)

Timeline for d1pqub2: