Lineage for d1pqua1 (1pqu A:1-133,A:358-371)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 477749Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 477790Protein Aspartate beta-semialdehyde dehydrogenase [51813] (3 species)
  7. 477802Species Haemophilus influenzae [TaxId:727] [102159] (10 PDB entries)
  8. 477814Domain d1pqua1: 1pqu A:1-133,A:358-371 [104288]
    Other proteins in same PDB: d1pqua2, d1pqub2, d1pquc2, d1pqud2

Details for d1pqua1

PDB Entry: 1pqu (more details), 1.92 Å

PDB Description: crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with nadp, s-methyl cysteine sulfoxide and cacodylate

SCOP Domain Sequences for d1pqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqua1 c.2.1.3 (A:1-133,A:358-371) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae}
mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
seglkkgiktfvgXaaepvrrilkqlva

SCOP Domain Coordinates for d1pqua1:

Click to download the PDB-style file with coordinates for d1pqua1.
(The format of our PDB-style files is described here.)

Timeline for d1pqua1: