Lineage for d1pqpa2 (1pqp A:134-357)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915728Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 1915740Species Haemophilus influenzae [TaxId:727] [103103] (12 PDB entries)
    Uniprot P44801
  8. 1915750Domain d1pqpa2: 1pqp A:134-357 [104287]
    Other proteins in same PDB: d1pqpa1
    complexed with hse, po4; mutant

Details for d1pqpa2

PDB Entry: 1pqp (more details), 2.06 Å

PDB Description: crystal structure of the c136s mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with aspartate semialdehyde and phosphate
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1pqpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqpa2 d.81.1.1 (A:134-357) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
gnstvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkd
passildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnk
ilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndke
itlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwg

SCOPe Domain Coordinates for d1pqpa2:

Click to download the PDB-style file with coordinates for d1pqpa2.
(The format of our PDB-style files is described here.)

Timeline for d1pqpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pqpa1