Lineage for d1ppjv_ (1ppj V:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237679Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 2237680Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 2237695Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 2237696Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 2237697Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
    Uniprot P13272 1-57 ! Uniprot P13272
  8. 2237701Domain d1ppjv_: 1ppj V: [104280]
    Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjw_
    complexed with any, azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma

Details for d1ppjv_

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin
PDB Compounds: (V:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d1ppjv_:

Sequence, based on SEQRES records: (download)

>d1ppjv_ d.184.1.3 (V:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
aavpatsespvldlklsvlcreslrgqaagrplvasvslnvpasvry

Sequence, based on observed residues (ATOM records): (download)

>d1ppjv_ d.184.1.3 (V:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
aavpatsespvlsvlcreslrgqaagrplvasvslnvpasvry

SCOPe Domain Coordinates for d1ppjv_:

Click to download the PDB-style file with coordinates for d1ppjv_.
(The format of our PDB-style files is described here.)

Timeline for d1ppjv_: