Lineage for d1ppjr2 (1ppj R:1-69)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519895Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 520129Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 520130Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 520131Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 520142Species Cow (Bos taurus) [TaxId:9913] [81497] (12 PDB entries)
  8. 520145Domain d1ppjr2: 1ppj R:1-69 [104276]
    Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_

Details for d1ppjr2

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin

SCOP Domain Sequences for d1ppjr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppjr2 f.23.12.1 (R:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus)}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOP Domain Coordinates for d1ppjr2:

Click to download the PDB-style file with coordinates for d1ppjr2.
(The format of our PDB-style files is described here.)

Timeline for d1ppjr2: