| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.1: MPP-like [63412] (4 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
| Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [56000] (12 PDB entries) |
| Domain d1ppjo2: 1ppj O:236-439 [104270] Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_ |
PDB Entry: 1ppj (more details), 2.1 Å
SCOP Domain Sequences for d1ppjo2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ppjo2 d.185.1.1 (O:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel
Timeline for d1ppjo2:
View in 3DDomains from other chains: (mouse over for more information) d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_ |