Details for d1ppjj_

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin

SCOP Domain Sequences for d1ppjj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppjj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
fferafdqgadaiyehinegklwkhikhkyenk

SCOP Domain Coordinates for d1ppjj_:

Click to download the PDB-style file with coordinates for d1ppjj_.
(The format of our PDB-style files is described here.)

Timeline for d1ppjj_: