![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
![]() | Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) ![]() not a true superfamily |
![]() | Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins) beta-hairpin and a short alpha-helix bound to the core subunits |
![]() | Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries) there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop Uniprot P13272 1-57 ! Uniprot P13272 |
![]() | Domain d1ppji_: 1ppj I: [104265] Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjw_ complexed with any, azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma |
PDB Entry: 1ppj (more details), 2.1 Å
SCOPe Domain Sequences for d1ppji_:
Sequence, based on SEQRES records: (download)
>d1ppji_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]} aavpatsespvldlklsvlcreslrgqaagrplvasvslnvpasvry
>d1ppji_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]} aavpatsespvlsvlcreslrgqaagrplvasvslnvpasvry
Timeline for d1ppji_:
![]() Domains from other chains: (mouse over for more information) d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_ |