Lineage for d1ppji_ (1ppj I:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515341Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 515342Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) (S)
    not a true superfamily
  5. 515353Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 515354Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 515355Species Cow (Bos taurus) [TaxId:9913] [90079] (9 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
  8. 515357Domain d1ppji_: 1ppj I: [104265]
    Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjw_

Details for d1ppji_

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin

SCOP Domain Sequences for d1ppji_:

Sequence, based on SEQRES records: (download)

>d1ppji_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus)}
aavpatsespvldlklsvlcreslrgqaagrplvasvslnvpasvry

Sequence, based on observed residues (ATOM records): (download)

>d1ppji_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus)}
aavpatsespvlsvlcreslrgqaagrplvasvslnvpasvry

SCOP Domain Coordinates for d1ppji_:

Click to download the PDB-style file with coordinates for d1ppji_.
(The format of our PDB-style files is described here.)

Timeline for d1ppji_: