SCOPe 2.07: Domain d1ppjg_: 1ppj G:

Lineage for d1ppjg_ (1ppj G:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Cow (Bos taurus) [TaxId:9913] [81503] (21 PDB entries)
   Uniprot P13271 #SP ! Uniprot P13271

8. Domain d1ppjg_: 1ppj G: [104263]
   Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppju_, d1ppjv_, d1ppjw_
   complexed with any, azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma

Details for d1ppjg_

PDB Entry: 1ppj, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin

PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d1ppjg_:

Sequence; same for both SEQRES and ATOM records:

>d1ppjg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

Timeline for d1ppjg_:

• d1ppjg_ first appeared in SCOP 1.69
  
• d1ppjg_ appears in SCOPe 2.06
  
• d1ppjg_ appears in the current release, SCOPe 2.08