SCOPe 2.01: Domain d1ppje2: 1ppj E:1-69

Lineage for d1ppje2 (1ppj E:1-69)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81497] (12 PDB entries)
   Uniprot P13272; precursor of chains I,E and V,R

8. Domain d1ppje2: 1ppj E:1-69 [104261]
   Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_
   complexed with any, azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma

Details for d1ppje2

PDB Entry: 1ppj, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin

PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d1ppje2:

Sequence; same for both SEQRES and ATOM records:

>d1ppje2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

Timeline for d1ppje2:

• d1ppje2 first appeared in SCOP 1.69
  
• d1ppje2 appears in SCOP 1.75
  
• d1ppje2 appears in SCOPe 2.02
  
• d1ppje2 appears in the current release, SCOPe 2.08