SCOPe 2.02: Domain d1ppjd2: 1ppj D:196-241

Lineage for d1ppjd2 (1ppj D:196-241)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries)
   Uniprot P00125

8. Domain d1ppjd2: 1ppj D:196-241 [104259]
   Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_
   complexed with any, azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma

Details for d1ppjd2

PDB Entry: 1ppj, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d1ppjd2:

Sequence; same for both SEQRES and ATOM records:

>d1ppjd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

Timeline for d1ppjd2:

• d1ppjd2 first appeared in SCOP 1.69
  
• d1ppjd2 appears in SCOPe 2.01
  
• d1ppjd2 appears in SCOPe 2.03
  
• d1ppjd2 appears in the current release, SCOPe 2.08