Lineage for d1ppjd1 (1ppj D:1-195)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078002Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1078003Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1078415Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 1078416Protein Cytochrome bc1 domain [46677] (3 species)
  7. 1078432Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries)
    Uniprot P00125
  8. 1078435Domain d1ppjd1: 1ppj D:1-195 [104258]
    Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_
    complexed with any, azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma

Details for d1ppjd1

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d1ppjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppjd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d1ppjd1:

Click to download the PDB-style file with coordinates for d1ppjd1.
(The format of our PDB-style files is described here.)

Timeline for d1ppjd1: