![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50025] (19 PDB entries) |
![]() | Domain d1pp9r1: 1pp9 R:70-196 [104245] Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_ complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, uq |
PDB Entry: 1pp9 (more details), 2.1 Å
SCOPe Domain Sequences for d1pp9r1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pp9r1 b.33.1.1 (R:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts ddmvivg
Timeline for d1pp9r1:
![]() Domains from other chains: (mouse over for more information) d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_ |