SCOP 1.69: Domain d1pp9p1: 1pp9 P:261-379

Lineage for d1pp9p1 (1pp9 P:261-379)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81643] (12 PDB entries)

8. Domain d1pp9p1: 1pp9 P:261-379 [104241]
   Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_

Details for d1pp9p1

PDB Entry: 1pp9, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

SCOP Domain Sequences for d1pp9p1:

Sequence; same for both SEQRES and ATOM records:

>d1pp9p1 f.32.1.1 (P:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus)}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

Timeline for d1pp9p1:

• d1pp9p1 is new in SCOP 1.69
  
• d1pp9p1 appears in SCOP 1.71
  
• d1pp9p1 appears in the current release, SCOPe 2.08