Details for d1pp9j_

PDB Entry: 1pp9 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOP Domain Sequences for d1pp9j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp9j_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
nk

SCOP Domain Coordinates for d1pp9j_:

Click to download the PDB-style file with coordinates for d1pp9j_.
(The format of our PDB-style files is described here.)

Timeline for d1pp9j_: