SCOP 1.69: Domain d1pp9f_: 1pp9 F:

Lineage for d1pp9f_ (1pp9 F:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81519] (12 PDB entries)

8. Domain d1pp9f_: 1pp9 F: [104232]
   Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_

Details for d1pp9f_

PDB Entry: 1pp9, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

SCOP Domain Sequences for d1pp9f_:

Sequence; same for both SEQRES and ATOM records:

>d1pp9f_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
wlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikraldlsmr
qqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d1pp9f_:

• d1pp9f_ is new in SCOP 1.69
  
• d1pp9f_ appears in SCOP 1.71
  
• d1pp9f_ appears in the current release, SCOPe 2.08