![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.103: CytB endotoxin-like [55675] (1 superfamily) core: beta-alpha(2)-beta-alpha(2)-beta(4); 3 layers: a/b/a |
![]() | Superfamily d.103.1: CytB endotoxin-like [55676] (1 family) ![]() |
![]() | Family d.103.1.1: CytB endotoxin-like [55677] (2 proteins) Pfam PF01338 |
![]() | Protein Volvatoxin A2 [111090] (1 species) |
![]() | Species Volvariella volvacea, different isoforms [TaxId:36659] [111091] (4 PDB entries) Uniprot Q6USC4 |
![]() | Domain d1pp6d_: 1pp6 D: [104220] |
PDB Entry: 1pp6 (more details), 3.2 Å
SCOPe Domain Sequences for d1pp6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pp6d_ d.103.1.1 (D:) Volvatoxin A2 {Volvariella volvacea, different isoforms [TaxId: 36659]} nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi dalelvvkkgfkap
Timeline for d1pp6d_:
![]() Domains from other chains: (mouse over for more information) d1pp6a_, d1pp6b_, d1pp6c_, d1pp6e_ |