Lineage for d1pp6c_ (1pp6 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608816Fold d.103: CytB endotoxin-like [55675] (1 superfamily)
    core: beta-alpha(2)-beta-alpha(2)-beta(4); 3 layers: a/b/a
  4. 608817Superfamily d.103.1: CytB endotoxin-like [55676] (1 family) (S)
  5. 608818Family d.103.1.1: CytB endotoxin-like [55677] (2 proteins)
    Pfam 01338
  6. 608822Protein Volvatoxin A2 [111090] (1 species)
  7. 608823Species Volvariella volvacea, different isoforms [TaxId:36659] [111091] (4 PDB entries)
  8. 608833Domain d1pp6c_: 1pp6 C: [104219]

Details for d1pp6c_

PDB Entry: 1pp6 (more details), 3.2 Å

PDB Description: vva2 (strip crystal form)

SCOP Domain Sequences for d1pp6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp6c_ d.103.1.1 (C:) Volvatoxin A2 {Volvariella volvacea, different isoforms}
nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
dalelvvkkgfkap

SCOP Domain Coordinates for d1pp6c_:

Click to download the PDB-style file with coordinates for d1pp6c_.
(The format of our PDB-style files is described here.)

Timeline for d1pp6c_: