Lineage for d1pp6b_ (1pp6 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532536Fold d.103: CytB endotoxin-like [55675] (1 superfamily)
    core: beta-alpha(2)-beta-alpha(2)-beta(4); 3 layers: a/b/a
  4. 2532537Superfamily d.103.1: CytB endotoxin-like [55676] (1 family) (S)
  5. 2532538Family d.103.1.1: CytB endotoxin-like [55677] (2 proteins)
    Pfam PF01338
  6. 2532542Protein Volvatoxin A2 [111090] (1 species)
  7. 2532543Species Volvariella volvacea, different isoforms [TaxId:36659] [111091] (4 PDB entries)
    Uniprot Q6USC4
  8. 2532552Domain d1pp6b_: 1pp6 B: [104218]

Details for d1pp6b_

PDB Entry: 1pp6 (more details), 3.2 Å

PDB Description: vva2 (strip crystal form)
PDB Compounds: (B:) volvatoxin A2

SCOPe Domain Sequences for d1pp6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp6b_ d.103.1.1 (B:) Volvatoxin A2 {Volvariella volvacea, different isoforms [TaxId: 36659]}
nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
dalelvvkkgfkap

SCOPe Domain Coordinates for d1pp6b_:

Click to download the PDB-style file with coordinates for d1pp6b_.
(The format of our PDB-style files is described here.)

Timeline for d1pp6b_: