SCOP 1.73: Domain d1pp6a_: 1pp6 A:

Lineage for d1pp6a_ (1pp6 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.103: CytB endotoxin-like [55675] (1 superfamily)
   core: beta-alpha(2)-beta-alpha(2)-beta(4); 3 layers: a/b/a

4. Superfamily d.103.1: CytB endotoxin-like [55676] (1 family)

5. Family d.103.1.1: CytB endotoxin-like [55677] (2 proteins)
   Pfam PF01338

6. Protein Volvatoxin A2 [111090] (1 species)

7. Species Volvariella volvacea, different isoforms [TaxId:36659] [111091] (4 PDB entries)

8. Domain d1pp6a_: 1pp6 A: [104217]

Details for d1pp6a_

PDB Entry: 1pp6, 3.2 Å

PDB Description: vva2 (strip crystal form)

PDB Compounds: (A:) volvatoxin A2

SCOP Domain Sequences for d1pp6a_:

Sequence; same for both SEQRES and ATOM records:

>d1pp6a_ d.103.1.1 (A:) Volvatoxin A2 {Volvariella volvacea, different isoforms [TaxId: 36659]}
nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
dalelvvkkgfkap

Timeline for d1pp6a_:

• d1pp6a_ first appeared in SCOP 1.69
  
• d1pp6a_ appears in SCOP 1.71
  
• d1pp6a_ appears in SCOP 1.75
  
• d1pp6a_ appears in the current release, SCOPe 2.08