Lineage for d1pp3a_ (1pp3 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779642Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 1779643Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 1779644Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 1779652Protein Thaumatin [49876] (1 species)
  7. 1779653Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (53 PDB entries)
    Uniprot P02883
  8. 1779677Domain d1pp3a_: 1pp3 A: [104215]

Details for d1pp3a_

PDB Entry: 1pp3 (more details), 1.6 Å

PDB Description: structure of thaumatin in a hexagonal space group
PDB Compounds: (A:) thaumatin I

SCOPe Domain Sequences for d1pp3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp3a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d1pp3a_:

Click to download the PDB-style file with coordinates for d1pp3a_.
(The format of our PDB-style files is described here.)

Timeline for d1pp3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pp3b_