SCOPe 2.08: Domain d1pp3a_: 1pp3 A:

Lineage for d1pp3a_ (1pp3 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
   automatically mapped to Pfam PF00314

6. Protein Thaumatin [49876] (1 species)

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (117 PDB entries)
   Uniprot P02883

8. Domain d1pp3a_: 1pp3 A: [104215]

Details for d1pp3a_

PDB Entry: 1pp3, 1.6 Å

PDB Description: structure of thaumatin in a hexagonal space group

PDB Compounds: (A:) thaumatin I

SCOPe Domain Sequences for d1pp3a_:

Sequence; same for both SEQRES and ATOM records:

>d1pp3a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d1pp3a_:

• d1pp3a_ first appeared in SCOP 1.69
  
• d1pp3a_ appears in SCOPe 2.07