Lineage for d1pp0d_ (1pp0 D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532536Fold d.103: CytB endotoxin-like [55675] (1 superfamily)
    core: beta-alpha(2)-beta-alpha(2)-beta(4); 3 layers: a/b/a
  4. 2532537Superfamily d.103.1: CytB endotoxin-like [55676] (1 family) (S)
  5. 2532538Family d.103.1.1: CytB endotoxin-like [55677] (2 proteins)
    Pfam PF01338
  6. 2532542Protein Volvatoxin A2 [111090] (1 species)
  7. 2532543Species Volvariella volvacea, different isoforms [TaxId:36659] [111091] (4 PDB entries)
    Uniprot Q6USC4
  8. 2532547Domain d1pp0d_: 1pp0 D: [104214]
    complexed with acy

Details for d1pp0d_

PDB Entry: 1pp0 (more details), 1.42 Å

PDB Description: volvatoxin A2 in monoclinic crystal
PDB Compounds: (D:) volvatoxin A2

SCOPe Domain Sequences for d1pp0d_:

Sequence, based on SEQRES records: (download)

>d1pp0d_ d.103.1.1 (D:) Volvatoxin A2 {Volvariella volvacea, different isoforms [TaxId: 36659]}
nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
dalelvvkkgfkap

Sequence, based on observed residues (ATOM records): (download)

>d1pp0d_ d.103.1.1 (D:) Volvatoxin A2 {Volvariella volvacea, different isoforms [TaxId: 36659]}
nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
nvkknssweyrvlfsvpfapsyfyslvttilitadieektgwwgltsstkknfavqidal
elvvkkgfkap

SCOPe Domain Coordinates for d1pp0d_:

Click to download the PDB-style file with coordinates for d1pp0d_.
(The format of our PDB-style files is described here.)

Timeline for d1pp0d_: