Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.103: CytB endotoxin-like [55675] (1 superfamily) core: beta-alpha(2)-beta-alpha(2)-beta(4); 3 layers: a/b/a |
Superfamily d.103.1: CytB endotoxin-like [55676] (1 family) |
Family d.103.1.1: CytB endotoxin-like [55677] (2 proteins) Pfam PF01338 |
Protein Volvatoxin A2 [111090] (1 species) |
Species Volvariella volvacea, different isoforms [TaxId:36659] [111091] (4 PDB entries) Uniprot Q6USC4 |
Domain d1pp0b_: 1pp0 B: [104212] complexed with acy |
PDB Entry: 1pp0 (more details), 1.42 Å
SCOPe Domain Sequences for d1pp0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pp0b_ d.103.1.1 (B:) Volvatoxin A2 {Volvariella volvacea, different isoforms [TaxId: 36659]} nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi dalelvvkkgfkap
Timeline for d1pp0b_: