Lineage for d1pp0a_ (1pp0 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509090Fold d.103: CytB endotoxin-like (Pfam 01338) [55675] (1 superfamily)
    core: beta-alpha(2)-beta-alpha(2)-beta(4); 3 layers: a/b/a
  4. 509091Superfamily d.103.1: CytB endotoxin-like (Pfam 01338) [55676] (1 family) (S)
  5. 509092Family d.103.1.1: CytB endotoxin-like (Pfam 01338) [55677] (2 proteins)
  6. 509096Protein Volvatoxin A2 [111090] (1 species)
  7. 509097Species Volvariella volvacea [111091] (2 PDB entries)
  8. 509098Domain d1pp0a_: 1pp0 A: [104211]

Details for d1pp0a_

PDB Entry: 1pp0 (more details), 1.42 Å

PDB Description: volvatoxin A2 in monoclinic crystal

SCOP Domain Sequences for d1pp0a_:

Sequence, based on SEQRES records: (download)

>d1pp0a_ d.103.1.1 (A:) Volvatoxin A2 {Volvariella volvacea}
nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
dalelvvkkgfkap

Sequence, based on observed residues (ATOM records): (download)

>d1pp0a_ d.103.1.1 (A:) Volvatoxin A2 {Volvariella volvacea}
nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
nvkknssweyrvlfsvpfapsyfyslvttilitadieektgwwgltsstkknfavqidal
elvvkkgfkap

SCOP Domain Coordinates for d1pp0a_:

Click to download the PDB-style file with coordinates for d1pp0a_.
(The format of our PDB-style files is described here.)

Timeline for d1pp0a_: