Lineage for d1pokb2 (1pok B:63-346)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475145Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 475332Family c.1.9.13: Isoaspartyl dipeptidase, catalytic domain [89489] (1 protein)
  6. 475333Protein Isoaspartyl dipeptidase, catalytic domain [89490] (1 species)
  7. 475334Species Escherichia coli [TaxId:562] [89491] (5 PDB entries)
  8. 475342Domain d1pokb2: 1pok B:63-346 [104210]
    Other proteins in same PDB: d1poka1, d1pokb1

Details for d1pokb2

PDB Entry: 1pok (more details), 2.7 Å

PDB Description: crystal structure of isoaspartyl dipeptidase

SCOP Domain Sequences for d1pokb2:

Sequence, based on SEQRES records: (download)

>d1pokb2 c.1.9.13 (B:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli}
gfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllaktra
lneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlanma
aesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeqal
efarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlthi
gvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkg

Sequence, based on observed residues (ATOM records): (download)

>d1pokb2 c.1.9.13 (B:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli}
gfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllaktra
lneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlanma
aesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeqal
efarkggtiditssidepvapaegiaravqagiplarvtlssdgngsvagfetlletvqv
lvkdydfsisdalrpltssvagflnltgkg

SCOP Domain Coordinates for d1pokb2:

Click to download the PDB-style file with coordinates for d1pokb2.
(The format of our PDB-style files is described here.)

Timeline for d1pokb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pokb1