Lineage for d1pokb1 (1pok B:1-62,B:347-388)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471748Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 471749Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 471864Family b.92.1.7: Isoaspartyl dipeptidase [89438] (1 protein)
  6. 471865Protein Isoaspartyl dipeptidase [89439] (1 species)
  7. 471866Species Escherichia coli [TaxId:562] [89440] (5 PDB entries)
  8. 471874Domain d1pokb1: 1pok B:1-62,B:347-388 [104209]
    Other proteins in same PDB: d1poka2, d1pokb2

Details for d1pokb1

PDB Entry: 1pok (more details), 2.7 Å

PDB Description: crystal structure of isoaspartyl dipeptidase

SCOP Domain Sequences for d1pokb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pokb1 b.92.1.7 (B:1-62,B:347-388) Isoaspartyl dipeptidase {Escherichia coli}
midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
cpXeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfe

SCOP Domain Coordinates for d1pokb1:

Click to download the PDB-style file with coordinates for d1pokb1.
(The format of our PDB-style files is described here.)

Timeline for d1pokb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pokb2