Class b: All beta proteins [48724] (144 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.7: Isoaspartyl dipeptidase [89438] (1 protein) |
Protein Isoaspartyl dipeptidase [89439] (1 species) |
Species Escherichia coli [TaxId:562] [89440] (5 PDB entries) |
Domain d1pokb1: 1pok B:1-62,B:347-388 [104209] Other proteins in same PDB: d1poka2, d1pokb2 |
PDB Entry: 1pok (more details), 2.7 Å
SCOP Domain Sequences for d1pokb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pokb1 b.92.1.7 (B:1-62,B:347-388) Isoaspartyl dipeptidase {Escherichia coli} midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil cpXeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfe
Timeline for d1pokb1: