Lineage for d1poka2 (1pok A:63-346)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. Family c.1.9.13: Isoaspartyl dipeptidase, catalytic domain [89489] (1 protein)
  6. Protein Isoaspartyl dipeptidase, catalytic domain [89490] (1 species)
  7. Species Escherichia coli [TaxId:562] [89491] (5 PDB entries)
    Uniprot P39377
  8. Domain d1poka2: 1pok A:63-346 [104208]
    Other proteins in same PDB: d1poka1, d1pokb1
    complexed with asn, so4, zn

Details for d1poka2

PDB Entry: 1pok (more details), 2.7 Å

PDB Description: crystal structure of isoaspartyl dipeptidase
PDB Compounds: (A:) Isoaspartyl dipeptidase

SCOPe Domain Sequences for d1poka2:

Sequence, based on SEQRES records: (download)

>d1poka2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]}
gfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllaktra
lneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlanma
aesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeqal
efarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlthi
gvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkg

Sequence, based on observed residues (ATOM records): (download)

>d1poka2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]}
gfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllaktra
lneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlanma
aesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeqal
efarkggtiditssidepvapaegiaravqagiplarvtlssdgngshigvagfetllet
vqvlvkdydfsisdalrpltssvagflnltgkg

SCOPe Domain Coordinates for d1poka2 are not available.

Timeline for d1poka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1poka1
View in 3D
Domains from other chains:
(mouse over for more information)
d1pokb1, d1pokb2