Lineage for d1poja1 (1poj A:1-62,A:347-388)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428473Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2428474Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2428652Family b.92.1.7: Isoaspartyl dipeptidase [89438] (1 protein)
  6. 2428653Protein Isoaspartyl dipeptidase [89439] (1 species)
  7. 2428654Species Escherichia coli [TaxId:562] [89440] (5 PDB entries)
    Uniprot P39377
  8. 2428663Domain d1poja1: 1poj A:1-62,A:347-388 [104203]
    Other proteins in same PDB: d1poja2, d1pojb2
    complexed with ae1, zn

Details for d1poja1

PDB Entry: 1poj (more details), 3.3 Å

PDB Description: Isoaspartyl Dipeptidase with bound inhibitor
PDB Compounds: (A:) Isoaspartyl dipeptidase

SCOPe Domain Sequences for d1poja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poja1 b.92.1.7 (A:1-62,A:347-388) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]}
midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
cpXeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfe

SCOPe Domain Coordinates for d1poja1:

Click to download the PDB-style file with coordinates for d1poja1.
(The format of our PDB-style files is described here.)

Timeline for d1poja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1poja2