SCOPe 2.08: Domain d1po9b1: 1po9 B:1-62,B:347-388

Lineage for d1po9b1 (1po9 B:1-62,B:347-388)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.7: Isoaspartyl dipeptidase [89438] (1 protein)

6. Protein Isoaspartyl dipeptidase [89439] (1 species)

7. Species Escherichia coli [TaxId:562] [89440] (5 PDB entries)
   Uniprot P39377

8. Domain d1po9b1: 1po9 B:1-62,B:347-388 [104201]
   Other proteins in same PDB: d1po9a2, d1po9b2
   complexed with zn

Details for d1po9b1

PDB Entry: 1po9, 2 Å

PDB Description: Crytsal structure of isoaspartyl dipeptidase

PDB Compounds: (B:) Isoaspartyl dipeptidase

SCOPe Domain Sequences for d1po9b1:

Sequence; same for both SEQRES and ATOM records:

>d1po9b1 b.92.1.7 (B:1-62,B:347-388) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]}
midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
cpXeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfe

Timeline for d1po9b1:

• d1po9b1 first appeared in SCOP 1.69
  
• d1po9b1 appears in SCOPe 2.07