Lineage for d1po9a2 (1po9 A:63-346)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084828Family c.1.9.13: Isoaspartyl dipeptidase, catalytic domain [89489] (1 protein)
  6. 2084829Protein Isoaspartyl dipeptidase, catalytic domain [89490] (1 species)
  7. 2084830Species Escherichia coli [TaxId:562] [89491] (5 PDB entries)
    Uniprot P39377
  8. 2084833Domain d1po9a2: 1po9 A:63-346 [104200]
    Other proteins in same PDB: d1po9a1, d1po9b1
    complexed with zn

Details for d1po9a2

PDB Entry: 1po9 (more details), 2 Å

PDB Description: Crytsal structure of isoaspartyl dipeptidase
PDB Compounds: (A:) Isoaspartyl dipeptidase

SCOPe Domain Sequences for d1po9a2:

Sequence, based on SEQRES records: (download)

>d1po9a2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]}
gfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllaktra
lneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlanma
aesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeqal
efarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlthi
gvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkg

Sequence, based on observed residues (ATOM records): (download)

>d1po9a2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]}
gfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllaktra
lneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlanma
aesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeqal
efarkggtiditssidepvapaegiaravqagiplarvtlssdgngvagfetlletvqvl
vkdydfsisdalrpltssvagflnltgkg

SCOPe Domain Coordinates for d1po9a2:

Click to download the PDB-style file with coordinates for d1po9a2.
(The format of our PDB-style files is described here.)

Timeline for d1po9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1po9a1