Lineage for d1pmzd_ (1pmz D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 538145Family a.39.1.10: Polcalcin [89048] (3 proteins)
    calcium-binding pollen allergen; two EF-hands per subunit
  6. 538153Protein procalcin che a 3 [109816] (1 species)
  7. 538154Species Pigweed (Chenopodium album) [TaxId:3559] [109817] (1 PDB entry)
  8. 538158Domain d1pmzd_: 1pmz D: [104198]
    complexed with ca, so4

Details for d1pmzd_

PDB Entry: 1pmz (more details), 1.9 Å

PDB Description: Structure of the calcium-binding pollen allergen Che a 3

SCOP Domain Sequences for d1pmzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmzd_ a.39.1.10 (D:) procalcin che a 3 {Pigweed (Chenopodium album)}
dtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfis
fdeftdfaranrglvkdvskif

SCOP Domain Coordinates for d1pmzd_:

Click to download the PDB-style file with coordinates for d1pmzd_.
(The format of our PDB-style files is described here.)

Timeline for d1pmzd_: